Mertk kinase domain in complex with purine inhibitor
PDB DOI: 10.2210/pdb7aw0/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2020-11-06 Deposition Author(s): Blackett, C. , Clarke, M. , Collingwood, O. , Disch, J. , Ginkunja, D. , Goldberg, K. , Guilinger, J. , Hardaker, E. , Hennessy, E.J. , Jetson, R. , Keefe, A. , Mccoull, W. , Mcmurray, L. , Nissink, J.W.M. , Overman, R. , Pflug, A. , Preston, M. , Rawlins, P. , Rivers, E. , Schimpl, M. , Smith, P. , Truman, C. , Underwood, E. , Warwicker, J. , Winter, J. , Woodcock, S. , Zhang, Y.
Mertk kinase domain in complex with purine inhibitor
Blackett, C. , Clarke, M. , Collingwood, O. , Disch, J. , Ginkunja, D. , Goldberg, K. , Guilinger, J. , Hardaker, E. , Hennessy, E.J. , Jetson, R. , Keefe, A. , Mccoull, W. , Mcmurray, L. , Nissink, J.W.M. , Overman, R. , Pflug, A. , Preston, M. , Rawlins, P. , Rivers, E. , Schimpl, M. , Smith, P. , Truman, C. , Underwood, E. , Warwicker, J. , Winter, J. , Woodcock, S. , Zhang, Y.
Primary Citation of Related Structures: 7AW0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tyrosine-protein kinase Mer | A | 298 | Salmonella Enterica | GSHMEELQNKLEDVVIDRNLLILGRILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPRHIPLQTLLRFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLERLLESLPDV |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-06 Deposition Author(s): Blackett, C. , Clarke, M. , Collingwood, O. , Disch, J. , Ginkunja, D. , Goldberg, K. , Guilinger, J. , Hardaker, E. , Hennessy, E.J. , Jetson, R. , Keefe, A. , Mccoull, W. , Mcmurray, L. , Nissink, J.W.M. , Overman, R. , Pflug, A. , Preston, M. , Rawlins, P. , Rivers, E. , Schimpl, M. , Smith, P. , Truman, C. , Underwood, E. , Warwicker, J. , Winter, J. , Woodcock, S. , Zhang, Y.