Crystal structure of chloroplastic thioredoxin z defines a novel type-specific target recognition
PDB DOI: 10.2210/pdb7asw/pdb
Classification: ISOMERASE Organism(s): Chlamydomonas Reinhardtii
Deposited: 2020-10-28 Deposition Author(s): Crozet, P. , Gurrieri, L. , Henri, J. , Le Moigne, T. , Lemaire, S.D. , Marchand, C.H. , Sparla, F. , Zaffagnini, M.
Method: X-RAY DIFFRACTION Resolution: 2.444 Å
Crystal structure of chloroplastic thioredoxin z defines a novel type-specific target recognition
Crozet, P. , Gurrieri, L. , Henri, J. , Le Moigne, T. , Lemaire, S.D. , Marchand, C.H. , Sparla, F. , Zaffagnini, M.
Primary Citation of Related Structures: 7ASW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin-related protein CITRX | A | 149 | Chlamydomonas Reinhardtii | MGSSHHHHHHSSGLVPRGSHMVISHGKVEKISGEQLEVAIASRDTTLIVDFFATWCGPCLLLARELEQVAEEMDGRVKVVKIDVDENPDLSNMLRIQGLPTIVIIPKDAGKPALRTEGFLPAAQIMEIVGQIEAGQTPGQPQQPEAPQQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-10-28 Deposition Author(s): Crozet, P. , Gurrieri, L. , Henri, J. , Le Moigne, T. , Lemaire, S.D. , Marchand, C.H. , Sparla, F. , Zaffagnini, M.