Cell division protein sepf from methanobrevibacter smithii in complex with ftsz-ctd
PDB DOI: 10.2210/pdb7al2/pdb
Classification: CELL CYCLE Organism(s): Sphingobium Sp. Tcm1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-10-04 Deposition Author(s): Alzari, P.M. , Sogues, A. , Wehenkel, A.M.
Cell division protein sepf from methanobrevibacter smithii in complex with ftsz-ctd
Alzari, P.M. , Sogues, A. , Wehenkel, A.M.
Primary Citation of Related Structures: 7AL2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cell division protein SepF | A | 96 | Sphingobium Sp. Tcm1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DDVSISPEQSFYEIMLIRPKTIDDINYVVDQVLEESNPVILDLSFLEKESPANFKLAGEKIKQMRSNYGAEALLLSRCNDKNLIIIAPKGVSLVRK |
Cell division protein FtsZ | B | 10 | Sphingobium Sp. Tcm1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QLDDFIDGIF |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-10-04 Deposition Author(s): Alzari, P.M. , Sogues, A. , Wehenkel, A.M.