Crystal structure of mertk kinase domain in complex with ldc1267
PDB DOI: 10.2210/pdb7aax/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2020-09-05 Deposition Author(s): Mccoull, W. , Nissink, J.W.M. , Overman, R.C. , Pflug, A. , Rawlins, P.B. , Schimpl, M. , Truman, C. , Underwood, E. , Warwicker, J. , Winter-Holt, J.
Method: X-RAY DIFFRACTION Resolution: 1.762 Å
Crystal structure of mertk kinase domain in complex with ldc1267
Mccoull, W. , Nissink, J.W.M. , Overman, R.C. , Pflug, A. , Rawlins, P.B. , Schimpl, M. , Truman, C. , Underwood, E. , Warwicker, J. , Winter-Holt, J.
Primary Citation of Related Structures: 7AAX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase Mer | A | 298 | Homo Sapiens | GSHMEELQNKLEDVVIDRNLLILGRILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPRHIPLQTLLRFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLERLLESLPDV |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-05 Deposition Author(s): Mccoull, W. , Nissink, J.W.M. , Overman, R.C. , Pflug, A. , Rawlins, P.B. , Schimpl, M. , Truman, C. , Underwood, E. , Warwicker, J. , Winter-Holt, J.