7AA7
Structure of scoc ps12/ps18 lir motif bound to gabarapl1
PDB DOI: 10.2210/pdb7aa7/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-09-03 Deposition Author(s): Dhira, J. , Lee, R. , Mouilleron, S. , O Reilly, N. , Tooze, S. , Wirth, M. , Zhang, W.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Structure of scoc ps12/ps18 lir motif bound to gabarapl1
Dhira, J. , Lee, R. , Mouilleron, S. , O Reilly, N. , Tooze, S. , Wirth, M. , Zhang, W.
Primary Citation of Related Structures: 7AA7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gamma-aminobutyric acid receptor-associated protein-like 1 | A | 123 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPTMGSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| Gamma-aminobutyric acid receptor-associated protein-like 1 | B | 123 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPTMGSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| pS12/pS18 SCOC LIR | P | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EEDSTFTNISL |
| pS12/pS18 SCOC LIR | Q | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EEDSTFTNISL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-03 Deposition Author(s): Dhira, J. , Lee, R. , Mouilleron, S. , O Reilly, N. , Tooze, S. , Wirth, M. , Zhang, W.