Crystal structure of shank1 pdz domain with arap3-derived peptide
PDB DOI: 10.2210/pdb7a9b/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Pandinus Imperator
Deposited: 2020-09-01 Deposition Author(s): Ali, M. , Ivarsson, Y. , Joerger, A.C. , Knapp, S. , Mariam Mcauley, M. , Structural Genomics Consortium (Sgc)
Crystal structure of shank1 pdz domain with arap3-derived peptide
Ali, M. , Ivarsson, Y. , Joerger, A.C. , Knapp, S. , Mariam Mcauley, M. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 7A9B
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SH3 and multiple ankyrin repeat domains protein 1,Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 | A | 140 | Salmonella Enterica , Pandinus Imperator | GAMGPGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDAAAGSGSGSFPELIQDTSTSFSTTR |
SH3 and multiple ankyrin repeat domains protein 1,Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 | B | 140 | Salmonella Enterica , Pandinus Imperator | GAMGPGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDAAAGSGSGSFPELIQDTSTSFSTTR |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-01 Deposition Author(s): Ali, M. , Ivarsson, Y. , Joerger, A.C. , Knapp, S. , Mariam Mcauley, M. , Structural Genomics Consortium (Sgc)