Intertwined dimer of the c-src sh3 domain mutant t125s
PDB DOI: 10.2210/pdb7a3d/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus
Deposited: 2020-08-18 Deposition Author(s): Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.
Intertwined dimer of the c-src sh3 domain mutant t125s
Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.
Primary Citation of Related Structures: 7A3D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD |
| Proto-oncogene tyrosine-protein kinase Src | B | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-18 Deposition Author(s): Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.