Crystal structure of the c-src sh3 domain mutant v111l-n113s-t114s-q128e at ph 7.0
PDB DOI: 10.2210/pdb7a39/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus
Deposited: 2020-08-18 Deposition Author(s): Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Crystal structure of the c-src sh3 domain mutant v111l-n113s-t114s-q128e at ph 7.0
Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.
Primary Citation of Related Structures: 7A39
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQILNSSEGDWWLAHSLTTGETGYIPSNYVAPSD |
Proto-oncogene tyrosine-protein kinase Src | B | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQILNSSEGDWWLAHSLTTGETGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-18 Deposition Author(s): Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.