7A34
Intertwined dimer of the c-src sh3 domain mutant v111l-n113s-t114s
PDB DOI: 10.2210/pdb7a34/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus
Deposited: 2020-08-18 Deposition Author(s): Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Intertwined dimer of the c-src sh3 domain mutant v111l-n113s-t114s
Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.
Primary Citation of Related Structures: 7A34
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus | GVTTFVALYDYESRTETDLSFKKGERLQILNSSEGDWWLAHSLTTGQTGYIPSNYVAPSD |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-18 Deposition Author(s): Camara-Artigas, A. , Plaza-Garrido, M. , Salinas-Garcia, M.C.