Advanced Search:
7A1H
Crystal structure of wild-type ci2
PDB DOI: 10.2210/pdb7a1h/pdb
Classification: PROTEIN BINDING Organism(s): Actinomadura Kijaniata
Deposited: 2020-08-13 Deposition Author(s): Hamborg, L. , Olsen, J.G. , Roche, J.V. , Teilum, K.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of wild-type ci2
Hamborg, L. , Olsen, J.G. , Roche, J.V. , Teilum, K.
Primary Citation of Related Structures: 7A1H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Subtilisin-chymotrypsin inhibitor-2A | A | 64 | Actinomadura Kijaniata | MKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPRVG |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-13 Deposition Author(s): Hamborg, L. , Olsen, J.G. , Roche, J.V. , Teilum, K.