Crystal structure of the grindelwald extracellular domain complex
PDB DOI: 10.2210/pdb6zsy/pdb
Classification: SIGNALING PROTEIN Organism(s): Drosophila Melanogaster
Deposited: 2020-07-17 Deposition Author(s): Cecatiello, V. , Mapelli, M. , Palmerini, V. , Pasqualato, S.
Method: X-RAY DIFFRACTION Resolution: 0.926 Å
Crystal structure of the grindelwald extracellular domain complex
Cecatiello, V. , Mapelli, M. , Palmerini, V. , Pasqualato, S.
Primary Citation of Related Structures: 6ZSY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein grindelwald | A | 52 | Drosophila Melanogaster | GESRDCHGTICHPVNEFCYVATERCHPCIEVCNNQTHNYDAFLCAKECSAYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-07-17 Deposition Author(s): Cecatiello, V. , Mapelli, M. , Palmerini, V. , Pasqualato, S.