3d electron diffraction structure of bovine insulin
PDB DOI: 10.2210/pdb6zhb/pdb
Classification: HORMONE Organism(s): Parengyodontium Album
Deposited: 2020-06-22 Deposition Author(s): Abrahams, J.P. , Bacia-Verloop, M. , Blum, T. , Clabbers, M.T.B. , Housset, D. , Ling, W.L. , Mccarthy, A.A. , Schoehn, G. , Van Genderen, E. , Zander, U.
3d electron diffraction structure of bovine insulin
Abrahams, J.P. , Bacia-Verloop, M. , Blum, T. , Clabbers, M.T.B. , Housset, D. , Ling, W.L. , Mccarthy, A.A. , Schoehn, G. , Van Genderen, E. , Zander, U.
Primary Citation of Related Structures: 6ZHB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin | A | 21 | Parengyodontium Album | GIVEQCCASVCSLYQLENYCN |
Insulin | C | 21 | Parengyodontium Album | GIVEQCCASVCSLYQLENYCN |
Insulin | B | 30 | Parengyodontium Album | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Insulin | D | 30 | Parengyodontium Album | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: ELECTRON CRYSTALLOGRAPHY
Deposited Date: 2020-06-22 Deposition Author(s): Abrahams, J.P. , Bacia-Verloop, M. , Blum, T. , Clabbers, M.T.B. , Housset, D. , Ling, W.L. , Mccarthy, A.A. , Schoehn, G. , Van Genderen, E. , Zander, U.