Structure of ctx-m-15 e166q mutant crystallised in the presence of enmetazobactam (aai101)
PDB DOI: 10.2210/pdb6z7h/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Klebsiella Pneumoniae Is53
Deposited: 2020-05-31 Deposition Author(s): Hinchliffe, P. , Spencer, J. , Tooke, C.L.
Structure of ctx-m-15 e166q mutant crystallised in the presence of enmetazobactam (aai101)
Hinchliffe, P. , Spencer, J. , Tooke, C.L.
Primary Citation of Related Structures: 6Z7H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta-lactamase | A | 265 | Klebsiella Pneumoniae Is53 | GPQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCATSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTQPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-31 Deposition Author(s): Hinchliffe, P. , Spencer, J. , Tooke, C.L.