Nmr solution structure of the carbohydrate-binding module family 5 (cbm5) from cellvibrio japonicus cjlpmo10a
PDB DOI: 10.2210/pdb6z40/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Cellvibrio Japonicus (Strain Ueda107)
Deposited: 2020-05-22 Deposition Author(s): Aachmann, F.L. , Courtade, G. , Madland, E.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the carbohydrate-binding module family 5 (cbm5) from cellvibrio japonicus cjlpmo10a
Aachmann, F.L. , Courtade, G. , Madland, E.
Primary Citation of Related Structures: 6Z40
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carbohydrate binding protein, putative, cpb33A | A | 67 | Cellvibrio Japonicus (Strain Ueda107) | MDTCATLPSWDASTVYTNPQQVKHNSKRYQANYWTQNQNPSTNSGQYGPWLDLGNCVTSGAHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2020-05-22 Deposition Author(s): Aachmann, F.L. , Courtade, G. , Madland, E.