Three-dimensional structure of an influenza hemagglutinin lah protein in its post-fusion conformation
PDB DOI: 10.2210/pdb6z2t/pdb
Classification: VIRAL PROTEIN Organism(s): Influenza A Virus (A/Mexico City/63/2009(H1N1))
Deposited: 2020-05-18 Deposition Author(s): Kazaks, A. , Kirsteina, A. , Tars, K.
Method: X-RAY DIFFRACTION Resolution: 1.34 Å
Three-dimensional structure of an influenza hemagglutinin lah protein in its post-fusion conformation
Kazaks, A. , Kirsteina, A. , Tars, K.
Primary Citation of Related Structures: 6Z2T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hemagglutinin | A | 58 | Influenza A Virus (A/Mexico City/63/2009(H1N1)) | MEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNA |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-18 Deposition Author(s): Kazaks, A. , Kirsteina, A. , Tars, K.