Crystal structure of wild type ogpa from akkermansia muciniphila in complex with an o-glycopeptide (galgalnac-ts) product
PDB DOI: 10.2210/pdb6z2q/pdb
Classification: HYDROLASE Organism(s): Akkermansia Muciniphila Atcc Baa-835 , Synthetic Construct
Deposited: 2020-05-18 Deposition Author(s): Anso, I. , Guerin, M.E. , Naegali, A. , Sjogren, J. , Trastoy, B.
Method: X-RAY DIFFRACTION Resolution: 2.347 Å
Crystal structure of wild type ogpa from akkermansia muciniphila in complex with an o-glycopeptide (galgalnac-ts) product
Anso, I. , Guerin, M.E. , Naegali, A. , Sjogren, J. , Trastoy, B.
Primary Citation of Related Structures: 6Z2Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| O-glycan protease | A | 371 | Akkermansia Muciniphila Atcc Baa-835 , Synthetic Construct | MEVTVPDALKDRIALKKTARQLNIVYFLGSDTEPVPDYERRLSELLLYLQQFYGKEMQRHGYGARSFGLDIKSPGRVNIIEYKAKNPAAHYPYENGGGWKAAQELDEFFKAHPDRKKSQHTLIIMPTWNDEKNGPDNPGGVPFYGMGRNCFALDYPAFDIKHLGQKTREGRLLTKWYGGMAHELGHGLNLPHNHQTASDGKKYGTALMGSGNYTFGTSPTFLTPASCALLDACEVFSVTPSQQFYEGKPEVEVGDVAISFKGDQILVSGNYKSPQTVKALNVYIQDPPYAVNQDYDAVSFSRRLGKKSGKFSMKIDKKELEGLNNNEFRISLMFILANGLHMQKHFTFHWDALQDYRDGSKSGSGHHHHHH |
| Glycodrosocin | D | 19 | Akkermansia Muciniphila Atcc Baa-835 , Synthetic Construct | GKPRPYSPRPTSHPRPIRV |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-18 Deposition Author(s): Anso, I. , Guerin, M.E. , Naegali, A. , Sjogren, J. , Trastoy, B.