Vegf-a 13:107 crystallized with 3c bicyclic peptide
PDB DOI: 10.2210/pdb6z13/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-05-12 Deposition Author(s): Broussy, S. , Gaucher, J.-F. , Reille-Seroussi, M.
Vegf-a 13:107 crystallized with 3c bicyclic peptide
Broussy, S. , Gaucher, J.-F. , Reille-Seroussi, M.
Primary Citation of Related Structures: 6Z13
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
bicyclic peptide 3C | P | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | CDIHVLWEWECFEKL |
Vascular endothelial growth factor A | V | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK |
Vascular endothelial growth factor A | W | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-12 Deposition Author(s): Broussy, S. , Gaucher, J.-F. , Reille-Seroussi, M.