Structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148r variant
PDB DOI: 10.2210/pdb6yxc/pdb
Classification: FLUORESCENT PROTEIN Organism(s): Chloroflexus Aggregans (Strain Md-66 / Dsm 9485)
Deposited: 2020-04-30 Deposition Author(s): Gushchin, I. , Kovalev, K. , Nazarenko, V. , Remeeva, A.
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148r variant
Gushchin, I. , Kovalev, K. , Nazarenko, V. , Remeeva, A.
Primary Citation of Related Structures: 6YXC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Multi-sensor hybrid histidine kinase | A | 113 | Chloroflexus Aggregans (Strain Md-66 / Dsm 9485) | MASGMIVTDAGADQPIVFVNRAFSTITGYAPNEVLGRNARFLQGPQTDAATVARLREAIAAARPIQERILNYRKDGQPFWNQLSISPVRDETGNVVAFVGVRTDVTAHHHHHH |
| Multi-sensor hybrid histidine kinase | B | 113 | Chloroflexus Aggregans (Strain Md-66 / Dsm 9485) | MASGMIVTDAGADQPIVFVNRAFSTITGYAPNEVLGRNARFLQGPQTDAATVARLREAIAAARPIQERILNYRKDGQPFWNQLSISPVRDETGNVVAFVGVRTDVTAHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-04-30 Deposition Author(s): Gushchin, I. , Kovalev, K. , Nazarenko, V. , Remeeva, A.