Crystal structure of shank1 pdz in complex with a peptide-small molecule hybrid
PDB DOI: 10.2210/pdb6yx0/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-04-30 Deposition Author(s): Celis, S. , Edwards, T.A. , Hegedus, Z. , Hobor, F. , Sessions, R.B. , Shoemark, D.K. , Trinh, C.H. , Wilson, A.J.
Crystal structure of shank1 pdz in complex with a peptide-small molecule hybrid
Celis, S. , Edwards, T.A. , Hegedus, Z. , Hobor, F. , Sessions, R.B. , Shoemark, D.K. , Trinh, C.H. , Wilson, A.J.
Primary Citation of Related Structures: 6YX0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SH3 and multiple ankyrin repeat domains protein 1 | A | 112 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDM |
SH3 and multiple ankyrin repeat domains protein 1 | B | 112 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDM |
PWQ-THR-ARG-LEU | C | 3 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TRL |
PWQ-THR-ARG-LEU | D | 3 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-04-30 Deposition Author(s): Celis, S. , Edwards, T.A. , Hegedus, Z. , Hobor, F. , Sessions, R.B. , Shoemark, D.K. , Trinh, C.H. , Wilson, A.J.