Mecp2 is a microsatellite binding protein that protects ca repeats from nucleosome invasion
PDB DOI: 10.2210/pdb6yww/pdb
Classification: DNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-04-30 Deposition Author(s): Bronner, C. , Dimitrov, S. , Gras, S.L. , Hamiche, A. , Ibrahim, A. , Klaholz, B.P. , Mohideen-Abdul, K. , Papin, C. , Stoll, I.
Mecp2 is a microsatellite binding protein that protects ca repeats from nucleosome invasion
Bronner, C. , Dimitrov, S. , Gras, S.L. , Hamiche, A. , Ibrahim, A. , Klaholz, B.P. , Mohideen-Abdul, K. , Papin, C. , Stoll, I.
Primary Citation of Related Structures: 6YWW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Truncated methyl CpG binding protein 2 transcript 1 | A | 101 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGRGSPAAAHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-04-30 Deposition Author(s): Bronner, C. , Dimitrov, S. , Gras, S.L. , Hamiche, A. , Ibrahim, A. , Klaholz, B.P. , Mohideen-Abdul, K. , Papin, C. , Stoll, I.