Structure the bromelain protease from ananas comosus in complex with the tlck inhibitor
PDB DOI: 10.2210/pdb6ycg/pdb
Classification: HYDROLASE Organism(s): Ananas Comosus
Deposited: 2020-03-18 Deposition Author(s): Azarkan, M. , Calvo Esposito, R. , Charlier, P. , Delbrassine, F. , Herman, R. , Kerff, F. , M Rabet, N. , Sauvage, E.
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Structure the bromelain protease from ananas comosus in complex with the tlck inhibitor
Azarkan, M. , Calvo Esposito, R. , Charlier, P. , Delbrassine, F. , Herman, R. , Kerff, F. , M Rabet, N. , Sauvage, E.
Primary Citation of Related Structures: 6YCG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FBSB | A | 216 | Ananas Comosus | AVPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASGAIYPYKAAKGTCKTNGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSNGKKYWIVKNSWGARWGEAGYIRMARDVSSSSGICGIAIDSLYPTLE |
| FBSB | B | 216 | Ananas Comosus | AVPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASGAIYPYKAAKGTCKTNGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSNGKKYWIVKNSWGARWGEAGYIRMARDVSSSSGICGIAIDSLYPTLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-03-18 Deposition Author(s): Azarkan, M. , Calvo Esposito, R. , Charlier, P. , Delbrassine, F. , Herman, R. , Kerff, F. , M Rabet, N. , Sauvage, E.