Crystal structure of p38 in complex with sr69
PDB DOI: 10.2210/pdb6y4w/pdb
Classification: TRANSFERASE Organism(s): Mus Musculus
Deposited: 2020-02-23 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A.M. , Knapp, S. , Roehm, S. , Structural Genomics Consortium (Sgc)
Crystal structure of p38 in complex with sr69
Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A.M. , Knapp, S. , Roehm, S. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 6Y4W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitogen-activated protein kinase 14 | A | 361 | Mus Musculus | GMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-02-23 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A.M. , Knapp, S. , Roehm, S. , Structural Genomics Consortium (Sgc)