Ccaat-binding complex from aspergillus fumigatus with cyca dna
PDB DOI: 10.2210/pdb6y35/pdb
Classification: TRANSCRIPTION Organism(s): Aspergillus Fumigatus A1163 , Neosartorya Fumigata (Strain Atcc Mya-4609 / Af293 / Cbs 101355 / Fgsc A1100) , Synthetic Construct
Deposited: 2020-02-17 Deposition Author(s): Groll, M. , Huber, E.M.
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Ccaat-binding complex from aspergillus fumigatus with cyca dna
Primary Citation of Related Structures: 6Y35
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CCAAT-binding transcription factor subunit HAPB | A | 64 | Aspergillus Fumigatus A1163 , Neosartorya Fumigata (Strain Atcc Mya-4609 / Af293 / Cbs 101355 / Fgsc A1100) , Synthetic Construct | MESPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLTADE |
| CCAAT-binding factor complex subunit HapC | B | 92 | Aspergillus Fumigatus A1163 , Neosartorya Fumigata (Strain Atcc Mya-4609 / Af293 / Cbs 101355 / Fgsc A1100) , Synthetic Construct | MKEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE |
| CCAAT-binding factor complex subunit HapE | C | 119 | Aspergillus Fumigatus A1163 , Neosartorya Fumigata (Strain Atcc Mya-4609 / Af293 / Cbs 101355 / Fgsc A1100) , Synthetic Construct | MGTWANVNQGLQGTARDILTTYWQHIINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDIFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-02-17 Deposition Author(s): Groll, M. , Huber, E.M.