Crystal structure of the c-src sh3 domain h122r-q128e mutant in complex with ni(ii) at ph 7.5 co-crystallized with methyl beta-cyclodextrin
PDB DOI: 10.2210/pdb6xx4/pdb
Classification: PROTEIN BINDING Organism(s): Caldanaerobius
Deposited: 2020-01-26 Deposition Author(s): Camara-Artigas, A.
Method: X-RAY DIFFRACTION Resolution: 1.05 Å
Crystal structure of the c-src sh3 domain h122r-q128e mutant in complex with ni(ii) at ph 7.5 co-crystallized with methyl beta-cyclodextrin
Primary Citation of Related Structures: 6XX4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 61 | Caldanaerobius | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLTTGETGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-01-26 Deposition Author(s): Camara-Artigas, A.