6XX3
Crystal structure of the c-src sh3 domain h122r-q128e mutant in complex with cu(ii) at ph 6.5 co-crystallized with methyl beta-cyclodextrin
PDB DOI: 10.2210/pdb6xx3/pdb
Classification: PROTEIN BINDING Organism(s): Caldanaerobius
Deposited: 2020-01-26 Deposition Author(s): Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.36 Å
Crystal structure of the c-src sh3 domain h122r-q128e mutant in complex with cu(ii) at ph 6.5 co-crystallized with methyl beta-cyclodextrin
Primary Citation of Related Structures: 6XX3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Caldanaerobius | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLTTGETGYIPSNYVAPSD |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-01-26 Deposition Author(s): Camara-Artigas, A.