Intrinsically disordered bacterial polar organizing protein z, popz, interacts with protein binding partners through an n-terminal molecular recognition feature
PDB DOI: 10.2210/pdb6xry/pdb
Classification: PROTEIN BINDING Organism(s): Caulobacter Vibrioides (Strain Atcc 19089 / Cb15)
Deposited: 2020-07-14 Deposition Author(s): Ahmed, Y.M. , Bowman, G.R. , Nordyke, C.T. , Puterbaugh, R.Z. , Varga, K.
Intrinsically disordered bacterial polar organizing protein z, popz, interacts with protein binding partners through an n-terminal molecular recognition feature
Ahmed, Y.M. , Bowman, G.R. , Nordyke, C.T. , Puterbaugh, R.Z. , Varga, K.
Primary Citation of Related Structures: 6XRY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polar organizing protein Z | A | 141 | Caulobacter Vibrioides (Strain Atcc 19089 / Cb15) | MSDQSQEPTMEEILASIRRIISEDDAPAEPAAEAAPPPPPEPEPEPVSFDDEVLELTDPIAPEPELPPLETVGDIDVYSPPEPESEPAYTPPPAAPVFDRDEVAEQLVGVSAASAAASAFGSLSSALLMPKDGLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2020-07-14 Deposition Author(s): Ahmed, Y.M. , Bowman, G.R. , Nordyke, C.T. , Puterbaugh, R.Z. , Varga, K.