Solution nmr structure of recifin, a cysteine-rich tyrosyl-dna phosphodiesterase i modulatory peptide from the marine sponge axinella sp.
PDB DOI: 10.2210/pdb6xn9/pdb
Classification: TOXIN Organism(s): Axinella Sp. 1 Tf-2017
Deposited: 2020-07-02 Deposition Author(s): O'Keefe, B.R. , Rosengren, K.J. , Schroeder, C.I.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of recifin, a cysteine-rich tyrosyl-dna phosphodiesterase i modulatory peptide from the marine sponge axinella sp.
O'Keefe, B.R. , Rosengren, K.J. , Schroeder, C.I.
Primary Citation of Related Structures: 6XN9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Recifin modulatory peptide | A | 42 | Axinella Sp. 1 Tf-2017 | QEAFCYSDRFCQNYIGSIPDCCFGRGSYSFELQPPPWECYQC |
Method: SOLUTION NMR
Deposited Date: 2020-07-02 Deposition Author(s): O'Keefe, B.R. , Rosengren, K.J. , Schroeder, C.I.