Structure of a mosquito complement inhibitor from anopheles freeborni
PDB DOI: 10.2210/pdb6xl7/pdb
Classification: PROTEIN BINDING Organism(s): Anopheles Freeborni
Deposited: 2020-06-28 Deposition Author(s): Andersen, J.F. , Strayer, E.
Structure of a mosquito complement inhibitor from anopheles freeborni
Primary Citation of Related Structures: 6XL7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SG7.AF | A | 119 | Anopheles Freeborni | ARKHVQELLKTFRRIDFDETRKSVYLQSAKFGVQSQLREPLTKKVLNYWDDVKLSKTCLDRMVTKVNDVKETFYAGFSYACESHNQYSVDCLEAAKPSYLTALGEIRGETEKCLTTRLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-06-28 Deposition Author(s): Andersen, J.F. , Strayer, E.