Crystal structure of the type iii secretion pilotin invh
PDB DOI: 10.2210/pdb6xfj/pdb
Classification: PROTEIN TRANSPORT Organism(s): Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720)
Deposited: 2020-06-15 Deposition Author(s): Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.
Crystal structure of the type iii secretion pilotin invh
Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.
Primary Citation of Related Structures: 6XFJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Type 3 secretion system pilotin | A | 82 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | GSHMDNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL |
Type 3 secretion system pilotin | B | 82 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | GSHMDNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL |
Type 3 secretion system pilotin | C | 82 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | GSHMDNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL |
Type 3 secretion system pilotin | D | 82 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | GSHMDNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-06-15 Deposition Author(s): Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.