Nmr structure of ost4v23d, a critical mutant of ost4, in dpc micelles
PDB DOI: 10.2210/pdb6xcu/pdb
Classification: MEMBRANE PROTEIN Organism(s): Saccharomyces Cerevisiae (Strain Yjm789)
Deposited: 2020-06-09 Deposition Author(s): Chaudhary, B.P.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of ost4v23d, a critical mutant of ost4, in dpc micelles
Primary Citation of Related Structures: 6XCU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Oligosaccharyltransferase | A | 45 | Saccharomyces Cerevisiae (Strain Yjm789) | MISDEQLNSLAITFGIVMMTLIDIYHAVDSTMSPKNRLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2020-06-09 Deposition Author(s): Chaudhary, B.P.