Crystal structure analysis of sin3-ume6
PDB DOI: 10.2210/pdb6xaw/pdb
Classification: TRANSCRIPTION Organism(s): Pseudomonas Chlororaphis Subsp. Piscium
Deposited: 2020-06-04 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.
Crystal structure analysis of sin3-ume6
Primary Citation of Related Structures: 6XAW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcriptional regulatory protein SIN3 | A | 76 | Pseudomonas Chlororaphis Subsp. Piscium | GPHMKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFLPD |
Transcriptional regulatory protein UME6 | B | 46 | Pseudomonas Chlororaphis Subsp. Piscium | GPRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDKPIS |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-06-04 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.