Solution nmr structure of de novo designed tmb2.3
PDB DOI: 10.2210/pdb6x1k/pdb
Classification: MEMBRANE PROTEIN Organism(s): Synthetic Construct
Deposited: 2020-05-19 Deposition Author(s): Baker, D. , Chow, C.M. , Liang, B. , Tamm, L.K. , Vorobieva, A.A.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of de novo designed tmb2.3
Baker, D. , Chow, C.M. , Liang, B. , Tamm, L.K. , Vorobieva, A.A.
Primary Citation of Related Structures: 6X1K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| De novo designed transmembrane beta-barrel TMB2.3 | A | 124 | Synthetic Construct | MQDGPGTLDVFVAAGWNTDNTIEITGGATYQLSPYIMVKAGYGWNNSSLNRFEFGGGLQYKVTPDLEPYAWAGATYNTDNTLVPAAGAGFRYKVSPEVKLVVEYGWNNSSLQFLQAGLSYRIQP |
Method: SOLUTION NMR
Deposited Date: 2020-05-19 Deposition Author(s): Baker, D. , Chow, C.M. , Liang, B. , Tamm, L.K. , Vorobieva, A.A.