Crystal structure of herc2 zz domain in complex with histone h3 tail
PDB DOI: 10.2210/pdb6ww4/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens
Deposited: 2020-05-07 Deposition Author(s): Kutateladze, T.G. , Liu, J. , Vann, K.R.
Method: X-RAY DIFFRACTION Resolution: 2.252 Å
Crystal structure of herc2 zz domain in complex with histone h3 tail
Kutateladze, T.G. , Liu, J. , Vann, K.R.
Primary Citation of Related Structures: 6WW4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone H3.1,E3 ubiquitin-protein ligase HERC2 | B | 56 | Homo Sapiens | ARTKQTIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRIN |
| Histone H3.1,E3 ubiquitin-protein ligase HERC2 | A | 56 | Homo Sapiens | ARTKQTIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRIN |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-07 Deposition Author(s): Kutateladze, T.G. , Liu, J. , Vann, K.R.