Crystal structure of herc2 zz domain in complex with sumo1 tail
PDB DOI: 10.2210/pdb6ww3/pdb
Classification: GENE REGULATION Organism(s): Salmonella Enterica
Deposited: 2020-05-07 Deposition Author(s): Kutateladze, T.G. , Liu, J. , Vann, K.R.
Crystal structure of herc2 zz domain in complex with sumo1 tail
Kutateladze, T.G. , Liu, J. , Vann, K.R.
Primary Citation of Related Structures: 6WW3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SUMO1 linked HERC2 ZZ domain (Small ubiquitin-related modifier 1,E3 ubiquitin-protein ligase HERC2) | A | 60 | Salmonella Enterica | SDQEAKIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQ |
SUMO1 linked HERC2 ZZ domain (Small ubiquitin-related modifier 1,E3 ubiquitin-protein ligase HERC2) | B | 60 | Salmonella Enterica | SDQEAKIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-07 Deposition Author(s): Kutateladze, T.G. , Liu, J. , Vann, K.R.