Solution structure of vicilin-buried peptide-10 from cucumber
PDB DOI: 10.2210/pdb6wqj/pdb
Classification: PLANT PROTEIN Organism(s): N.A.
Deposited: 2020-04-29 Deposition Author(s): Payne, C.D. , Rosengren, K.J.
Solution structure of vicilin-buried peptide-10 from cucumber
Primary Citation of Related Structures: 6WQJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Vicilin-buried peptide-10 | A | 35 | N.A. | QKETEICRQWCQVMKPQGGEEQRRCQQECEERLRD |
Method: SOLUTION NMR
Deposited Date: 2020-04-29 Deposition Author(s): Payne, C.D. , Rosengren, K.J.