Crystal structure of the grb2 sh2 domain in complex with a tripeptide: ac-py-ac6c-n-isohexyl
PDB DOI: 10.2210/pdb6wo2/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-04-24 Deposition Author(s): Clements, J.H. , Martin, S.F.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of the grb2 sh2 domain in complex with a tripeptide: ac-py-ac6c-n-isohexyl
Primary Citation of Related Structures: 6WO2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Growth factor receptor-bound protein 2 | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH |
Growth factor receptor-bound protein 2 | B | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH |
ACE-PTR-02K-ASN-U67 | C | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XYANX |
ACE-PTR-02K-ASN-U67 | D | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XYANX |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-04-24 Deposition Author(s): Clements, J.H. , Martin, S.F.