6WE1
Wheat dwarf virus rep domain complexed with a single-stranded dna 8-mer comprising the cleavage site
PDB DOI: 10.2210/pdb6we1/pdb
Classification: REPLICATION/DNA Organism(s): Dengue Virus Type 2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-04-01 Deposition Author(s): Evans Iii, R.L. , Gordon, W.R. , Litzau, L.A. , Nelson, A.T. , Pornschloegl, L. , Tompkins, K.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.612 Å
Wheat dwarf virus rep domain complexed with a single-stranded dna 8-mer comprising the cleavage site
Evans Iii, R.L. , Gordon, W.R. , Litzau, L.A. , Nelson, A.T. , Pornschloegl, L. , Tompkins, K.
Primary Citation of Related Structures: 6WE1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Replication-associated protein | A | 139 | Dengue Virus Type 2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MASSSTPRFRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELHEDGSPHLHVLVQNKLRASITNPNALNLRMDTSPFSIFHPNIQAAKDCNQVRDFITKEVDSDVNTAEWGTFVAVSTPGRKDRDADLE |
| Replication-associated protein | D | 139 | Dengue Virus Type 2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MASSSTPRFRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELHEDGSPHLHVLVQNKLRASITNPNALNLRMDTSPFSIFHPNIQAAKDCNQVRDFITKEVDSDVNTAEWGTFVAVSTPGRKDRDADLE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-04-01 Deposition Author(s): Evans Iii, R.L. , Gordon, W.R. , Litzau, L.A. , Nelson, A.T. , Pornschloegl, L. , Tompkins, K.