6WE0
Wheat dwarf virus rep domain complexed with a single-stranded dna 10-mer comprising the cleavage site
PDB DOI: 10.2210/pdb6we0/pdb
Classification: REPLICATION/DNA Organism(s): Dengue Virus Type 2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-04-01 Deposition Author(s): Evans Iii, R.L. , Gordon, W.R. , Litzau, L.A. , Nelson, A. , Shi, K. , Tompkins, K.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Wheat dwarf virus rep domain complexed with a single-stranded dna 10-mer comprising the cleavage site
Evans Iii, R.L. , Gordon, W.R. , Litzau, L.A. , Nelson, A. , Shi, K. , Tompkins, K.
Primary Citation of Related Structures: 6WE0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Replication-associated protein | A | 137 | Dengue Virus Type 2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MASSSTPRFRVYSKYLFLTYPQCTLEPQYALDSLRTLLNKYEPLYIAAVRELHEDGSPHLHVLVQNKLRASITNPNALNLRMDTSPFSIFHPNIQAAKDCNQVRDFITKEVDSDVNTAEWGTFVAVSTPGRKDRDAD |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(*TP*AP*AP*TP*AP*TP*TP*AP*CP*C)-3') | c | 10 | NA | TAATATTACC |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-04-01 Deposition Author(s): Evans Iii, R.L. , Gordon, W.R. , Litzau, L.A. , Nelson, A. , Shi, K. , Tompkins, K.