6WAY
C-terminal sh2 domain of p120rasgap in complex with p190rhogap phosphotyrosine peptide
PDB DOI: 10.2210/pdb6way/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-03-26 Deposition Author(s): Boggon, T.J. , Jaber Chehayeb, R. , Stiegler, A.L. , Wang, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
C-terminal sh2 domain of p120rasgap in complex with p190rhogap phosphotyrosine peptide
Boggon, T.J. , Jaber Chehayeb, R. , Stiegler, A.L. , Wang, J.
Primary Citation of Related Structures: 6WAY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ras GTPase-activating protein 1 | A | 107 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVSSFLVRPSDNTPGDYSLYFRTNENIQRFKISPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQ |
| Rho GTPase-activating protein 35 | V | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDYAEPMDAX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-03-26 Deposition Author(s): Boggon, T.J. , Jaber Chehayeb, R. , Stiegler, A.L. , Wang, J.