Structure of the c-terminal domain of rage and its inhibitor
PDB DOI: 10.2210/pdb6vxg/pdb
Classification: SIGNALING PROTEIN/INHIBITOR Organism(s): Homo Sapiens
Deposited: 2020-02-21 Deposition Author(s): Ramirez, L. , Shekhtman, A.
Structure of the c-terminal domain of rage and its inhibitor
Primary Citation of Related Structures: 6VXG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Advanced glycosylation end product-specific receptor | A | 43 | Homo Sapiens | MWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP |
Method: SOLUTION NMR
Deposited Date: 2020-02-21 Deposition Author(s): Ramirez, L. , Shekhtman, A.