Crystal structure of human klf4 zinc finger dna binding domain in complex with nanog dna
PDB DOI: 10.2210/pdb6vtx/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-02-13 Deposition Author(s): Choi, K.J. , Ferreon, A.C.M. , Ferreon, J.C. , Kim, C. , Mackenzie, K.R. , Sankaran, B. , Sharma, R. , Sharma, S.
Method: X-RAY DIFFRACTION Resolution: 2.14 Å
Crystal structure of human klf4 zinc finger dna binding domain in complex with nanog dna
Choi, K.J. , Ferreon, A.C.M. , Ferreon, J.C. , Kim, C. , Mackenzie, K.R. , Sankaran, B. , Sharma, R. , Sharma, S.
Primary Citation of Related Structures: 6VTX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Krueppel-like factor 4 | A | 84 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-02-13 Deposition Author(s): Choi, K.J. , Ferreon, A.C.M. , Ferreon, J.C. , Kim, C. , Mackenzie, K.R. , Sankaran, B. , Sharma, R. , Sharma, S.