6VNZ
Nmr solution structure of tamapin, mutant k20a
PDB DOI: 10.2210/pdb6vnz/pdb
Classification: TOXIN Organism(s): Hottentotta Tamulus
Deposited: 2020-01-29 Deposition Author(s): Del Rio Portilla, F. , Mayorga Flores, M. , Melchor Meneses, C.M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of tamapin, mutant k20a
Del Rio Portilla, F. , Mayorga Flores, M. , Melchor Meneses, C.M.
Primary Citation of Related Structures: 6VNZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin alpha-KTx 5.4 | A | 31 | Hottentotta Tamulus | AFCNLRRCELSCRSLGLLGACIGEECKCVPY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2020-01-29 Deposition Author(s): Del Rio Portilla, F. , Mayorga Flores, M. , Melchor Meneses, C.M.