Solution nmr structure of enterococcal cytolysin l (cylll"") produced by enterococcus faecalis
PDB DOI: 10.2210/pdb6vgt/pdb
Classification: TOXIN Organism(s): Enterococcus Faecalis
Deposited: 2020-01-08 Deposition Author(s): Bobeica, S.C. , Tang, W. , Van Der Donk, W.A. , Zhu, L.
Solution nmr structure of enterococcal cytolysin l (cylll"") produced by enterococcus faecalis
Bobeica, S.C. , Tang, W. , Van Der Donk, W.A. , Zhu, L.
Primary Citation of Related Structures: 6VGT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cytolysin L | A | 38 | Enterococcus Faecalis | ATPVCAVAATAAAASAACGWVGGGIFTGVTVVVALKHC |
Method: SOLUTION NMR
Deposited Date: 2020-01-08 Deposition Author(s): Bobeica, S.C. , Tang, W. , Van Der Donk, W.A. , Zhu, L.