Metal-bound c-terminal domain of czcd transporter from thermotoga maritima
PDB DOI: 10.2210/pdb6vda/pdb
Classification: TRANSPORT PROTEIN Organism(s): Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099)
Deposited: 2019-12-23 Deposition Author(s): Maher, M.J.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Metal-bound c-terminal domain of czcd transporter from thermotoga maritima
Primary Citation of Related Structures: 6VDA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ZT_dimer domain-containing protein | A | 101 | Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) | MDGMKRTELDMYDDIFAVLERFPNVHNPHRVRIRRVGTKYFIEMDIEVDGKMSVKDAHELTVKIRKEMLKRRDDIEDVTIHVEPLGNVEEEGFGLKKGEKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-23 Deposition Author(s): Maher, M.J.