Metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans
PDB DOI: 10.2210/pdb6vd9/pdb
Classification: TRANSPORT PROTEIN Organism(s): Cupriavidus Metallidurans (Strain Atcc 43123 / Dsm 2839 / Nbrc 102507 / Ch34)
Deposited: 2019-12-23 Deposition Author(s): Maher, M.J.
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans
Primary Citation of Related Structures: 6VD9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Metal cation efflux system protein CzcD | A | 75 | Cupriavidus Metallidurans (Strain Atcc 43123 / Dsm 2839 / Nbrc 102507 / Ch34) | DDVDLAEVEKQILATPGVKSFHDLHIWALTSGKASLTVHVVNDTAVNPEMEVLPELKQMLADKFDITHVTIQFEL |
Metal cation efflux system protein CzcD | B | 75 | Cupriavidus Metallidurans (Strain Atcc 43123 / Dsm 2839 / Nbrc 102507 / Ch34) | DDVDLAEVEKQILATPGVKSFHDLHIWALTSGKASLTVHVVNDTAVNPEMEVLPELKQMLADKFDITHVTIQFEL |
Metal cation efflux system protein CzcD | C | 75 | Cupriavidus Metallidurans (Strain Atcc 43123 / Dsm 2839 / Nbrc 102507 / Ch34) | DDVDLAEVEKQILATPGVKSFHDLHIWALTSGKASLTVHVVNDTAVNPEMEVLPELKQMLADKFDITHVTIQFEL |
Metal cation efflux system protein CzcD | D | 75 | Cupriavidus Metallidurans (Strain Atcc 43123 / Dsm 2839 / Nbrc 102507 / Ch34) | DDVDLAEVEKQILATPGVKSFHDLHIWALTSGKASLTVHVVNDTAVNPEMEVLPELKQMLADKFDITHVTIQFEL |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-23 Deposition Author(s): Maher, M.J.