Structure of human uracil dna glycosylase (udg) bound to aurintricarboxylic acid (ata)
PDB DOI: 10.2210/pdb6vba/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2019-12-18 Deposition Author(s): Arvai, A.S. , Moiani, D. , Tainer, J.A.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Structure of human uracil dna glycosylase (udg) bound to aurintricarboxylic acid (ata)
Arvai, A.S. , Moiani, D. , Tainer, J.A.
Primary Citation of Related Structures: 6VBA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uracil-DNA glycosylase | A | 223 | Homo Sapiens | MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-18 Deposition Author(s): Arvai, A.S. , Moiani, D. , Tainer, J.A.