Crystal structure of stringent starvation protein a (bth_i2974) from burkholderia thailandensis
PDB DOI: 10.2210/pdb6v91/pdb
Classification: STRUCTURAL GENOMICS Organism(s): Burkholderia Thailandensis E264
Deposited: 2019-12-12 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of stringent starvation protein a (bth_i2974) from burkholderia thailandensis
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 6V91
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Stringent starvation protein A | A | 211 | Burkholderia Thailandensis E264 | MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLLWRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRRGHHHHHHH |
| Stringent starvation protein A | B | 211 | Burkholderia Thailandensis E264 | MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLLWRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRRGHHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-12 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)