Crystal structure analysis of zebra fish mdmx
PDB DOI: 10.2210/pdb6v4g/pdb
Classification: APOPTOSIS Organism(s): Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-11-27 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.
Method: X-RAY DIFFRACTION Resolution: 1.25 Å
Crystal structure analysis of zebra fish mdmx
Primary Citation of Related Structures: 6V4G
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein Mdm4 | A | 104 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MHHHHHHDDDDKRTLPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQRQHIVHCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL |
Stapled peptide QSQQTF(0EH)NLWRLE(MK8)QN(NH2) | B | 17 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QSQQTFXNLWRLELQNX |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-27 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.