Crystal structure analysis of zebra fish mdm
PDB DOI: 10.2210/pdb6v4e/pdb
Classification: APOPTOSIS Organism(s): Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-11-27 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.
Crystal structure analysis of zebra fish mdm
Primary Citation of Related Structures: 6V4E
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein Mdm4 | A | 104 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MHHHHHHDDDDKRTLPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQRQHIVHCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL |
Protein Mdm4 | B | 104 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MHHHHHHDDDDKRTLPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQRQHIVHCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL |
Stapled peptide QSQQTF(0EH)NLWRLL(MK8)QN(NH2) | C | 17 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QSQQTFXNLWRLLLQNX |
Stapled peptide QSQQTF(0EH)NLWRLL(MK8)QN(NH2) | D | 17 | Bacillus Caldotenax , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QSQQTFXNLWRLLLQNX |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-27 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.