Crystal structure of chromodomain of mpp8 in complex with inhibitor unc3866
PDB DOI: 10.2210/pdb6v2s/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2019-11-25 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Crystal structure of chromodomain of mpp8 in complex with inhibitor unc3866
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R.
Primary Citation of Related Structures: 6V2S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| M-phase phosphoprotein 8 | A | 62 | Homo Sapiens , Synthetic Construct | GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK |
| M-phase phosphoprotein 8 | B | 62 | Homo Sapiens , Synthetic Construct | GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK |
| UNC3866 | C | 6 | Homo Sapiens , Synthetic Construct | XFALXX |
| UNC3866 | D | 6 | Homo Sapiens , Synthetic Construct | XFALXX |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-25 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R.